DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-126

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_494567.1 Gene:clec-126 / 173699 WormBaseID:WBGene00021117 Length:168 Species:Caenorhabditis elegans


Alignment Length:147 Identity:27/147 - (18%)
Similarity:41/147 - (27%) Gaps:63/147 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 TWF-------------------EAYVTCRKMNGHLANIQDE-------MELDGILALAPNNS--- 166
            |||                   .|...|:.....||.||::       .||.|.:.:....:   
 Worm    30 TWFLRSRGGWCMKVFTEALNQPSAEAKCKAAEAVLAGIQNKEEVAWMSKELTGTMWIGTKRTPPC 94

  Fly   167 ---------------YWIDISKLVENGGTFVSTLTGREPFFVKWKSNQDTKKKNQ-CVYIYAKEM 215
                           ||.|       |.|     .|.:.|:  |.|.:...:..| |..:.....
 Worm    95 MNSGVTKQCSQITSYYWTD-------GST-----VGVQGFY--WNSGEPNNQGGQGCAKLITSSS 145

  Fly   216 SYDE--CFEK--KSFVC 228
            ..|:  |..:  ..:||
 Worm   146 VLDDVACTTELTNGYVC 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 27/147 (18%)
clec-126NP_494567.1 CLECT 25..162 CDD:214480 25/145 (17%)

Return to query results.
Submit another query.