DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and clec-99

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_492872.1 Gene:clec-99 / 173011 WormBaseID:WBGene00013933 Length:226 Species:Caenorhabditis elegans


Alignment Length:109 Identity:19/109 - (17%)
Similarity:30/109 - (27%) Gaps:49/109 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 CRKMNGHLANIQDEMELDGILAL--------------------------------APNNSYWIDI 171
            |:.....|..:|::.|...|.:|                                :.|:.:|.| 
 Worm    87 CQSQGAVLTGVQNQEEAKKIASLLLPQISQQSGSIYIGLHRTPACSKSPISSSCNSMNSFHWTD- 150

  Fly   172 SKLVENGGTFVSTLTGREPFFVKWKSNQDTK---KKNQCVYIYA 212
                  |.|     ||.:...  |.:||...   ...||..:.|
 Worm   151 ------GST-----TGTDGLL--WNNNQPDNAHAATQQCAVLLA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 19/109 (17%)
clec-99NP_492872.1 CLECT 55..179 CDD:214480 18/105 (17%)

Return to query results.
Submit another query.