DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Mbl2

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001351987.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:135 Identity:31/135 - (22%)
Similarity:53/135 - (39%) Gaps:12/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SNIKASNN-IKMRRFEKVGSRHF--HIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALA 162
            |.::|..| :.....||||.::|  .::|..:.   .....|.:..|.:|..::..|...|..:|
Mouse   113 SELRALRNWVLFSLSEKVGKKYFVSSVKKMSLD---RVKALCSEFQGSVATPRNAEENSAIQKVA 174

  Fly   163 PNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQ--DTKKKNQCVYIYAKEMSYD-ECFEKK 224
            .:.:|.......||  |:| ..|||....:..|...:  :|.....||.|.......| .|.:..
Mouse   175 KDIAYLGITDVRVE--GSF-EDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSF 236

  Fly   225 SFVCQ 229
            ..:|:
Mouse   237 LAICE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 23/112 (21%)
Mbl2NP_001351987.1 Collagen 36..93 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..101
CLECT 132..242 CDD:382969 24/116 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.