DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Mbl1

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_034905.1 Gene:Mbl1 / 17194 MGIID:96923 Length:239 Species:Mus musculus


Alignment Length:161 Identity:33/161 - (20%)
Similarity:62/161 - (38%) Gaps:21/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 IASSLLEFKAQMEIQLQPLKIIMRHHASNI--KASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAY 136
            |...|...:|::.|....|::..:.||.::  |:...:.:...||:   .|...|:|        
Mouse    92 IEEKLANMEAEIRILKSKLQLTNKLHAFSMGKKSGKKLFVTNHEKM---PFSKVKSL-------- 145

  Fly   137 VTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQDT 201
              |.::.|.:|..::..|...|..:|...::.....:..|  |.|: .:||....:..||.::..
Mouse   146 --CTELQGTVAIPRNAEENKAIQEVATGIAFLGITDEATE--GQFM-YVTGGRLTYSNWKKDEPN 205

  Fly   202 K--KKNQCVYIYAKEMSYD-ECFEKKSFVCQ 229
            .  ....||.|....:..| .|......||:
Mouse   206 NHGSGEDCVIILDNGLWNDISCQASFKAVCE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 22/110 (20%)
Mbl1NP_034905.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..88
Collagen <37..89 CDD:189968
CLECT_collectin_like 127..237 CDD:153061 25/126 (20%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000250|UniProtKB:P19999 203..211 0/7 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.