DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klra17

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001368891.1 Gene:Klra17 / 170733 MGIID:2180674 Length:274 Species:Mus musculus


Alignment Length:57 Identity:13/57 - (22%)
Similarity:22/57 - (38%) Gaps:6/57 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MKKEFRSKAKQLSRLNDPNIVKLLGACLKDEPICIVLDYKFSTDLNQFLQEHTAETG 93
            ::|.:..|.|.|..:...|....:....|.||..:.:::.|.|      ..|..|.|
Mouse   457 VRKSWLPKTKPLHLVEGDNYSSFISDTGKIEPDMMSMEHSFET------ASHDGEAG 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480
Klra17NP_001368891.1 Ly49 41..159 CDD:462461
CLECT_NK_receptors_like 146..261 CDD:153063
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.