DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klra9

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_034781.2 Gene:Klra9 / 16640 MGIID:1321153 Length:266 Species:Mus musculus


Alignment Length:199 Identity:40/199 - (20%)
Similarity:68/199 - (34%) Gaps:49/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FTYNALKQ--NETL----------AIIDTMEMRIASSLLEFKAQMEIQLQPLKIIMRHHAS-NIK 104
            |.|:..||  ||||          :..:..|..:.:..::.:...|:    |..|.|.... |.:
Mouse    69 FQYSQHKQEINETLNHYHNCSNMQSDFNLKEEMLTNKSIDCRPSNEL----LDYIKREQDRWNSE 129

  Fly   105 ASNNIKMRRFEKVGSRH----------FHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGIL 159
            ....:...|....|.:|          |.:.|.   ||......|:..:..:..|:||.||..:.
Mouse   130 TKTVLDSSRDTGRGVKHWFCYGTKCYYFIMNKT---TWSGCKANCQHYSVPIVKIEDEDELKFLQ 191

  Fly   160 ALAPNNSYWIDIS--------KLVENGGTFVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMS 216
            ......||||.:|        ..::||.:.:...|.:..|           |...||::....:.
Mouse   192 RHVIPESYWIGLSYDKKKKEWAWIDNGQSKLDMKTRKMNF-----------KSRGCVFLSKARIE 245

  Fly   217 YDEC 220
            ..:|
Mouse   246 DTDC 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 24/118 (20%)
Klra9NP_034781.2 Ly49 40..157 CDD:400616 17/91 (19%)
CLECT_NK_receptors_like 145..259 CDD:153063 24/119 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.