DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klra5

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_032489.1 Gene:Klra5 / 16636 MGIID:101903 Length:266 Species:Mus musculus


Alignment Length:116 Identity:27/116 - (23%)
Similarity:46/116 - (39%) Gaps:24/116 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDIS--------KLVEN 177
            :|.:.||   ||.....||:..:..|..|:||.||..:.....::||||.:|        ..::|
Mouse   156 YFIMSKN---TWSGCKQTCQHYSLPLVKIEDEDELKFLQFQVISDSYWIGLSYDKKKKQWAWIDN 217

  Fly   178 GGTFVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVC 228
            |           |..:..|:.:...|...|:::....:....|  ..|:.|
Mouse   218 G-----------PSKLDMKTRKMNFKPGGCIFLSKTRLEDTNC--NNSYFC 255

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 27/116 (23%)