DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klra3

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_034778.2 Gene:Klra3 / 16634 MGIID:101905 Length:266 Species:Mus musculus


Alignment Length:198 Identity:38/198 - (19%)
Similarity:67/198 - (33%) Gaps:47/198 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FTYNALKQ--NETL-------------------AIIDTMEMRIASSLLEF-KAQMEIQLQPLKII 95
            |.||..||  ||||                   ....:::.|.::..||: |.:.:......|.:
Mouse    69 FQYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTV 133

  Fly    96 MRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILA 160
            :   .|:......:|..........:|.:.|.   ||......|:..:..:..|:||.||..:..
Mouse   134 L---DSSRDTGRGVKYWFCYSTKCYYFIMNKT---TWSGCKANCQHYSVPILKIEDEDELKFLQR 192

  Fly   161 LAPNNSYWIDIS--------KLVENGGTFVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSY 217
            .....:|||.:|        ..::||           |..:..|..:...|...||::....:..
Mouse   193 HVIPENYWIGLSYDKKKKEWAWIDNG-----------PSKLDMKIRKMNFKSRGCVFLSKARIED 246

  Fly   218 DEC 220
            .:|
Mouse   247 IDC 249

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 22/108 (20%)
Klra3NP_034778.2 Ly49 40..157 CDD:462461 16/90 (18%)
CLECT_NK_receptors_like 145..259 CDD:153063 23/119 (19%)
Involved in dimerization 147..151 0/3 (0%)
Implicated in MHC class I binding 160..162 0/1 (0%)