DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klra10

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_032485.2 Gene:Klra10 / 16628 MGIID:1321093 Length:266 Species:Mus musculus


Alignment Length:98 Identity:21/98 - (21%)
Similarity:35/98 - (35%) Gaps:19/98 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 TWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDIS--------KLVENGGTFVSTLTG 187
            ||......|:..:..:..|:||.||..:.......||||.:|        ..::||         
Mouse   163 TWSGCKANCQHYSVPIVKIEDEDELKFLQRHVIPESYWIGLSYDKKKKEWAWIDNG--------- 218

  Fly   188 REPFFVKWKSNQDTKKKNQCVYIYAKEMSYDEC 220
              |..:..|..:...|...||::....:...:|
Mouse   219 --PSKLDMKIRKMNFKSRGCVFLSKARIEDTDC 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/98 (21%)
Klra10NP_032485.2 Ly49 40..157 CDD:462461
CLECT_NK_receptors_like 145..257 CDD:153063 21/98 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.