DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CLEC2L

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001073980.2 Gene:CLEC2L / 154790 HGNCID:21969 Length:214 Species:Homo sapiens


Alignment Length:105 Identity:21/105 - (20%)
Similarity:35/105 - (33%) Gaps:25/105 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 WFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVE-----NGGTF---VSTLTGR 188
            |......|......||.||.:.||:.:.... ....||.:.::.:     ||..|   ..|:.| 
Human   121 WNTGRQYCHTHEAVLAVIQSQKELEFMFKFT-RREPWIGLRRVGDEFHWVNGDPFDPDTFTIAG- 183

  Fly   189 EPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVC 228
                           ..:||::....:...||...:.:||
Human   184 ---------------PGECVFVEPTRLVSTECLMTRPWVC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/105 (20%)
CLEC2LNP_001073980.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
CLECT_NK_receptors_like 100..210 CDD:153063 21/105 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.