DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Olr1

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_579840.2 Gene:Olr1 / 140914 RGDID:620515 Length:368 Species:Rattus norvegicus


Alignment Length:244 Identity:48/244 - (19%)
Similarity:85/244 - (34%) Gaps:60/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WNL--------WDLSGGQQDIPNGKATLPSPQTPQNTIDQIGINQNYWFTYNALKQNETLAIIDT 69
            |.|        |.|:|..::   .|..|...|..|..:.:..       .|:...|.|....|||
  Rat   149 WELKEQIDILNWKLNGISKE---QKELLQQNQNLQEALQKAE-------KYSEESQRELKEQIDT 203

  Fly    70 MEMRIASSLLEFKAQMEI--QLQPLKIIMRHHASN--------IKASNNIKMRRFEKVGSRHFHI 124
            :..::..   :.|.|.|:  |.|.|:..::..|::        |....|..:          ||.
  Rat   204 LSWKLNE---KSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYL----------FHG 255

  Fly   125 EKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNS--YWIDISK-------LVENGGT 180
            ..|    |.::...|..::..|..|....:|:.:|....:::  :|:.:.:       |.|||  
  Rat   256 PFN----WEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENG-- 314

  Fly   181 FVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQ 229
              |.|:.:  ||.....:........|.||....:..:.|......:||
  Rat   315 --SPLSFQ--FFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 22/116 (19%)
Olr1NP_579840.2 GBP_C <116..231 CDD:303769 21/94 (22%)
coiled coil 207..218 CDD:293879 2/13 (15%)
CLECT_NK_receptors_like 239..360 CDD:153063 26/141 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.