DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Colec12

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_569716.2 Gene:Colec12 / 140792 MGIID:2152907 Length:742 Species:Mus musculus


Alignment Length:122 Identity:27/122 - (22%)
Similarity:48/122 - (39%) Gaps:13/122 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILA-LAPNNSYWIDISKLVENGGTFVST 184
            :|.:||.:.:   :|.:.|...:.||..|....|...|.. .....|:||.::...:....  ..
Mouse   620 YFSLEKEIFE---DAKLFCEDKSSHLVFINSREEQQWIKKHTVGRESHWIGLTDSEQESEW--KW 679

  Fly   185 LTGREPFFVKWKSNQDTK------KKNQCV-YIYAKEMSYDECFEKKSFVCQADQWA 234
            |.|....:..||:.|...      ....|. .|||.:.:..:|.|..:|:|:.::.|
Mouse   680 LDGSPVDYKNWKAGQPDNWGSGHGPGEDCAGLIYAGQWNDFQCDEINNFICEKEREA 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/115 (22%)
Colec12NP_569716.2 PRK11281 85..>411 CDD:481316
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..608
Collagen 455..563 CDD:460189
CLECT_DC-SIGN_like 607..732 CDD:153060 26/116 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.