DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Asgr2

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_031519.1 Gene:Asgr2 / 11890 MGIID:88082 Length:301 Species:Mus musculus


Alignment Length:210 Identity:43/210 - (20%)
Similarity:67/210 - (31%) Gaps:70/210 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QNETLAIIDTMEMRIASSLLEF-----------------KAQMEIQLQPLK-------IIMRHHA 100
            |.|...:.:|.....:|:|:||                 .||:|.:.|.||       ..::|..
Mouse    85 QEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFP 149

  Fly   101 SNIKA---------SNNIK---MRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEM 153
            .:::.         ||..:   :...|..||.::.....|  ||.||...|:..|.||..|....
Mouse   150 MDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGL--TWAEADQYCQLENAHLLVINSRE 212

  Fly   154 ELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYD 218
            |.|.::........||.   |.:..|::            ||....|                |.
Mouse   213 EQDFVVKHRSQFHIWIG---LTDRDGSW------------KWVDGTD----------------YR 246

  Fly   219 ECFEKKSFVCQADQW 233
            ..:...:|. |.|.|
Mouse   247 SNYRNWAFT-QPDNW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/107 (20%)
Asgr2NP_031519.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Lectin_N 4..162 CDD:461106 14/76 (18%)
CLECT_DC-SIGN_like 170..295 CDD:153060 27/125 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.