DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Olr1

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_619589.2 Gene:Olr1 / 108078 MGIID:1261434 Length:363 Species:Mus musculus


Alignment Length:209 Identity:40/209 - (19%)
Similarity:79/209 - (37%) Gaps:55/209 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KQNETLAIIDTME---MRIASSLLEFKAQMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSR 120
            :|.|.|.:|..::   .|.|:|..|.:.:::.::..|.:.:           |.|.:..|::..:
Mouse   164 EQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKL-----------NEKSKEQEELLQK 217

  Fly   121 HFHIEKNLMQ--------------------------TWFEAYVTCRKMNGHLANIQDEMELDGIL 159
            :.::::.|.:                          :|.:...||:.:.|.|..|....:|..||
Mouse   218 NQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFIL 282

  Fly   160 -ALAPNNS-YWIDISK-------LVENGGTFVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEM 215
             |::...| :||.:.:       |.|||     |....:.|..:..|.|.....| |.|:....:
Mouse   283 QAISHTTSPFWIGLHRKKPGQPWLWENG-----TPLNFQFFKTRGVSLQLYSSGN-CAYLQDGAV 341

  Fly   216 SYDECFEKKSFVCQ 229
            ..:.|......:||
Mouse   342 FAENCILIAFSICQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 26/142 (18%)
Olr1NP_619589.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Neck 55..241 13/87 (15%)
Apolipoprotein 71..229 CDD:279749 13/75 (17%)
Seryl_tRNA_N <96..175 CDD:299883 4/10 (40%)
eIF-4B <156..214 CDD:283846 12/60 (20%)
CLECT_NK_receptors_like 235..356 CDD:153063 27/127 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.