DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CLEC4M

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_055072.3 Gene:CLEC4M / 10332 HGNCID:13523 Length:399 Species:Homo sapiens


Alignment Length:113 Identity:22/113 - (19%)
Similarity:47/113 - (41%) Gaps:16/113 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 NLMQTWFEAYVTCRKMNGHLANIQDEMELDGI-LALAPNNSY-WIDISKLVENG------GTFVS 183
            |..:.|.::...|:::...|..|:...|.:.: |..:.:|.: |:.:|.|.:.|      |:.:|
Human   284 NSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLS 348

  Fly   184 TLTGREPFFVK-WKSNQDTKKKNQ-CVYIYAKEMSYDECFEKKSFVCQ 229
                  |.|.: |.|.:.....|: |........:.:.|.....::|:
Human   349 ------PSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/111 (19%)
CLEC4MNP_055072.3 Endocytosis signal. /evidence=ECO:0000250 14..15
transmembrane domain 44..71
YhaN <58..>266 CDD:443752
7 X approximate tandem repeats 108..269
CLECT_DC-SIGN_like 268..391 CDD:153060 22/113 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.