DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and LOC101731294

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_031754021.1 Gene:LOC101731294 / 101731294 -ID:- Length:172 Species:Xenopus tropicalis


Alignment Length:174 Identity:42/174 - (24%)
Similarity:78/174 - (44%) Gaps:22/174 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IDTMEMRIASSLLEFKAQMEIQLQ-PLKIIMRHHASNIKASNNIKMRR--------FEKVGSRHF 122
            ||.:.:.:.||:|      .:||. |:|:..|..|...|..|.|..|:        ::.:.|:.:
 Frog     7 IDIISLLLCSSVL------SVQLNAPVKMEERLMAEITKLKNPITRRQLLSNCPENWQGIESKCY 65

  Fly   123 HIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTG 187
            :|....: ||.|:...|......|..::|:.|:|.:..|..|..:||.::|..::.....||:  
 Frog    66 YISTTTL-TWEESKNVCIAQGSSLLILKDKKEMDDLEPLVENKPFWIGMTKKGKSWQWLDSTI-- 127

  Fly   188 REPFFVKWKSNQ--DTKKKNQCVYIYAKEMSYDECFEKKSFVCQ 229
              |.|:.|..|:  |...|..|.....::.:..:|..|..::|:
 Frog   128 --PTFLPWAPNEPNDMNGKENCAESNGRQWNDIDCLVKGYYICK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/109 (23%)
LOC101731294XP_031754021.1 CLECT_NK_receptors_like 53..170 CDD:153063 27/122 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.