DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and pla2r1

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_031749202.1 Gene:pla2r1 / 100488773 XenbaseID:XB-GENE-1000168 Length:1473 Species:Xenopus tropicalis


Alignment Length:130 Identity:33/130 - (25%)
Similarity:51/130 - (39%) Gaps:31/130 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GSRHFHIEKNLMQT-----------WFEAYVTCRKMNGHLANIQDEMELDGILALAPNN--SYWI 169
            |..|...:...|||           |.||.|:|:...|.|.:|....|.:.|..:..:|  |:|:
 Frog   239 GCEHLWEQNQTMQTCYQFNLDSALSWHEARVSCQAQGGDLLSITSVDEQNYISGILGHNQVSFWM 303

  Fly   170 DISKLVENGGTFVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEM----SYDECFEK--KSFVC 228
            .::::.|..|...|  .|.......|:||          |.|..|.    :||...::  :||.|
 Frog   304 GLNQVEEASGWHWS--DGAPLALANWRSN----------YTYNYENGHCGTYDRLRDRGWQSFPC 356

  Fly   229  228
             Frog   357  356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 32/127 (25%)
pla2r1XP_031749202.1 RICIN 58..>141 CDD:214672
FN2 185..233 CDD:128373
CLECT 253..366 CDD:153057 28/116 (24%)
CLECT 386..511 CDD:214480
CLECT 526..655 CDD:214480
CLECT 684..809 CDD:214480
CLECT 828..951 CDD:214480
CLECT 974..1112 CDD:214480
CLECT 1132..1248 CDD:214480
CLECT 1263..1389 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12232
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.