DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and asgr1

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_002935447.4 Gene:asgr1 / 100487251 XenbaseID:XB-GENE-5998517 Length:211 Species:Xenopus tropicalis


Alignment Length:104 Identity:29/104 - (27%)
Similarity:52/104 - (50%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 MQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTL-TGREPFF 192
            |:.|.||...|:.||..|..|..|.|.:.:.:|...:.:||.:.:..:.......|| ...|.|:
 Frog   109 MKNWTEARAICKSMNSDLVVINSEREQNFLESLTDESEFWIGLKRDKDRWRWVDGTLHNPSEGFW 173

  Fly   193 VKWKSNQDTKKKNQCVYIYAKEMSYDE-C-FEKKSFVCQ 229
            :|.:.| ::..|..||:::..:...|: | |.:|:| |:
 Frog   174 MKGEPN-NSGGKEDCVHMWRDKKWNDKVCTFLQKAF-CE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 28/102 (27%)
asgr1XP_002935447.4 CLECT_DC-SIGN_like 91..211 CDD:153060 29/104 (28%)

Return to query results.
Submit another query.