DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and si:ch211-125e6.11

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001124136.1 Gene:si:ch211-125e6.11 / 100170830 ZFINID:ZDB-GENE-070912-35 Length:146 Species:Danio rerio


Alignment Length:104 Identity:23/104 - (22%)
Similarity:51/104 - (49%) Gaps:7/104 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 TWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNS-YWIDISKLVENGGTFVSTLTGREPFFVK 194
            :|..|...|:...|:||::.:.:|.|.::.:.|::| .||. ....|..|.::.| .|....:..
Zfish    42 SWITAEKNCQGFGGNLASVHNRLENDFLMNMVPSSSRCWIG-GHDGEQEGQWLWT-DGSMFDYNN 104

  Fly   195 WKSNQDTKKKNQ-CVYI-YAKEMSYDE--CFEKKSFVCQ 229
            |.|::...:::: |:.| :.....:::  |.....|:|:
Zfish   105 WCSDEPNNQRSENCMEINWTSNHCWNDQGCSTSMGFMCE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 22/102 (22%)
si:ch211-125e6.11NP_001124136.1 CLECT 32..144 CDD:153057 23/104 (22%)

Return to query results.
Submit another query.