DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and si:ch211-272h9.3

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001122059.1 Gene:si:ch211-272h9.3 / 100151549 ZFINID:ZDB-GENE-070705-165 Length:368 Species:Danio rerio


Alignment Length:122 Identity:28/122 - (22%)
Similarity:49/122 - (40%) Gaps:19/122 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLA---NIQDEMELDGILALAPNNSYWI-----DI 171
            |.|...:::|.:.  :.|.||...||:....||   |:.|.:.|...:..||..:.||     ::
Zfish    19 ECVQHHYYYINEG--KNWTEAQRYCREKYTDLATIDNMNDMIRLKKSVNDAPVENMWIGPRRTNV 81

  Fly   172 SKLVENGGTFVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVC 228
            .|...:.|..|        .|:.|.|.:.. ..|:|..:...:...:.|...:.|:|
Zfish    82 YKWHWSSGDPV--------LFLNWTSGEPA-GTNECTVMNNGQWDNEACNNTRVFIC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 26/116 (22%)
si:ch211-272h9.3NP_001122059.1 CLECT 25..131 CDD:295302 26/116 (22%)
CLECT 134..248 CDD:295302
CLECT 253..365 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11184
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.