DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and hbl4

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001108197.1 Gene:hbl4 / 100137128 ZFINID:ZDB-GENE-070912-287 Length:245 Species:Danio rerio


Alignment Length:123 Identity:27/123 - (21%)
Similarity:49/123 - (39%) Gaps:7/123 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPN-NSYWIDISKL- 174
            |.|:|||.: :::...|:..:..|...|......:...:.|.|...:::|... .|.::.:... 
Zfish   124 RMFKKVGQK-YYVSDGLVGNFETAQKFCSDAGAKIVLPRSEDENKVLISLQEALESTYVHVGATD 187

  Fly   175 VENGGTFVSTLTGREPFFVKWKSNQ--DTKKKNQCVYIYAKEMSYD-ECFEKKSFVCQ 229
            .:..|.||. |:.:...|..||..:  |......|..:|...:..| .|..|...||:
Zfish   188 AKKEGHFVD-LSDQPLTFTNWKEKEPNDYNGAEDCTAVYKTGVWNDINCNSKWHVVCE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/112 (19%)
hbl4NP_001108197.1 Collagen 32..94 CDD:460189
CLECT_collectin_like 131..245 CDD:153061 22/116 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.