DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and mrc2

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001090716.1 Gene:mrc2 / 100036697 XenbaseID:XB-GENE-486996 Length:1473 Species:Xenopus tropicalis


Alignment Length:98 Identity:24/98 - (24%)
Similarity:49/98 - (50%) Gaps:9/98 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 FHIEKNLMQTWFEAYVTCRKMNGHL---ANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVS 183
            |:.:..|  :|.||:.:||:.:.||   ..|.::..::|:|. ...::.|:.::.|..|||...|
 Frog   245 FNFQSAL--SWSEAWTSCRQQDAHLLSITEIHEQTYINGLLT-GYTSTLWMGLNDLDTNGGWQWS 306

  Fly   184 TLTGREPFFVKWKSNQDTKK-KNQCVYIYAKEM 215
              .|....::.|:|:|.:.. :..|..|..:.:
 Frog   307 --NGSPLKYLNWESDQPSNSMEENCAVIRTESL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 24/98 (24%)
mrc2NP_001090716.1 RICIN 43..>113 CDD:214672
FN2 174..222 CDD:128373
CLECT 241..355 CDD:153057 24/98 (24%)
CLECT 377..500 CDD:214480
CLECT 516..639 CDD:214480
CLECT 662..802 CDD:214480
CLECT 819..943 CDD:214480
CLECT 965..1101 CDD:214480
CLECT 1130..1238 CDD:153057
CLECT 1260..1387 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12232
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.