DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and mbl2

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_571645.2 Gene:mbl2 / 100008009 ZFINID:ZDB-GENE-000427-2 Length:251 Species:Danio rerio


Alignment Length:159 Identity:37/159 - (23%)
Similarity:67/159 - (42%) Gaps:28/159 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 MEIQLQPL--KIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLA 147
            ::.:||.|  ||.:.....|.|.        |:|||.: :::..::.:|:.:....|....|.|.
Zfish   107 LKSELQKLSDKIALIEKVVNFKT--------FKKVGQK-YYVTDDVEETFDKGMQYCSSNGGALV 162

  Fly   148 NIQDEMELDGILALAPNNSY---WIDISKLVENGGTFVST----LTGREPFFVKWKSNQ-DTKKK 204
             :...:|.:.:|.:..::::   :|.|:.. |..|.||.|    ||     |..|..|| |..|.
Zfish   163 -LPRTLEENALLKVFVSSAFKRLFIRITDR-EKEGEFVDTDRKKLT-----FTNWGPNQPDNYKG 220

  Fly   205 NQCVYIYAKEMSYDE--CFEKKSFVCQAD 231
            .|.....|....:|:  |......:|:.:
Zfish   221 AQDCGAIADSGLWDDVSCDSLYPIICEIE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 25/117 (21%)
mbl2NP_571645.2 CLECT_collectin_like 135..248 CDD:153061 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.