DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and hbl1

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_009296948.2 Gene:hbl1 / 100007982 ZFINID:ZDB-GENE-070912-285 Length:297 Species:Danio rerio


Alignment Length:215 Identity:45/215 - (20%)
Similarity:79/215 - (36%) Gaps:47/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PNGKATLPSPQTPQNTIDQIGINQNYWFTYNALKQNETLAIIDTMEMRIASSLLEFKAQMEIQLQ 90
            |.|||..|.|...|......|             ...:.::|:::             :.|||..
Zfish   119 PPGKAGPPGPDGAQGESGPPG-------------SPGSESVIESL-------------KSEIQNL 157

  Fly    91 PLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMEL 155
            ..||.....|::.  ||      |.|||.: :::...:..|:......|...:|.|...:...|.
Zfish   158 KAKIDTIEKAASF--SN------FRKVGQK-YYVTDRIFGTFDNGIKLCESSSGTLVVPKSSAEN 213

  Fly   156 DGILALAP-----NNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQ--DTKKKNQCVYIYAK 213
            ..::.:|.     |...:|.::. .|..|.||. :.|::..|.||...|  |.:....|..|...
Zfish   214 QALVRVAASSGLINEKPYIGVTD-KETEGQFVD-IEGKQLTFTKWGPGQPDDYQGAQDCGVIDVS 276

  Fly   214 EMSYDE--CFEKKSFVCQAD 231
            . ::|:  |.:.:..:|:.|
Zfish   277 G-TWDDGNCGDIRPIICEID 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 22/116 (19%)
hbl1XP_009296948.2 CLECT 178..294 CDD:321932 23/119 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.