DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13384 and CG13743

DIOPT Version :9

Sequence 1:NP_723383.1 Gene:CG13384 / 34160 FlyBaseID:FBgn0032036 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_610444.2 Gene:CG13743 / 35911 FlyBaseID:FBgn0033368 Length:528 Species:Drosophila melanogaster


Alignment Length:484 Identity:102/484 - (21%)
Similarity:183/484 - (37%) Gaps:108/484 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TNLQQIPEGAPRKKKMTERQPLLLQSDASDYEGSRGSAARPVRSSPPDNTLVNVHSEDSLAASGS 72
            |:.||   |.|::....::||...|......:                      ||:....|  .
  Fly    48 THQQQ---GQPQQPHQQQQQPPQQQQQQQHRQ----------------------HSQQQQQA--Q 85

  Fly    73 GDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMG 137
            .|..:|.|..|.          |.::|    :.:...:|:|::.:|.|...||..:||...:::.
  Fly    86 QDAGLGDTLSSL----------PQASF----NYINSIVGSGVIGIPYALHRAGFGLGLALLILVA 136

  Fly   138 AICTHCMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESGPLGLRRYSMLARRIVTTFLFITQIGF 202
            .|..:.:.::|.|.| :|.||..|.:  .|.||     |..|....|:|.    ..:.|:..|. 
  Fly   137 YITDYSLILMVRCGH-ICGRFSYPGI--MEAAY-----GKYGYYLLSLLQ----FMYPFLAMIS- 188

  Fly   203 CCVYFLFVALNIKDVMDHYY--------KMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALL 259
               |.:.|...:..|:..::        .:.:.:...:.:|.::.|.|.:|:..|...|.::...
  Fly   189 ---YNVVVGDTLSKVLVRFFPSWGGSMGAVRLGVVFFVNVGVVMPLCLYKNVSRLARASFISLAC 250

  Fly   260 TVAGL-AITFSYMLVDLPDVHTVKPVATW---------ATLPLYFGTAIYAFEGIGVVLPLENNM 314
            .|..| |:....|..|.....|.:   :|         ||     |..::||........:..:|
  Fly   251 VVFILFAVIIKLMSGDYKVTDTAE---SWRFANSDLIPAT-----GIMVFAFMCHHNTFLVYQSM 307

  Fly   315 R--TPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRISMAV 377
            |  |.|.:...|.:.......||.|:   |..||..:....:|.:..|....|.|....|:..::
  Fly   308 RDATMERWEKVTHISIGFAWTVAALF---GIAGYSTFRALSQGDLLENYCWDDDLMNFSRVLFSI 369

  Fly   378 AIFLSYTLQFYVPVNIVEPFVR--------SHFDTTRAKDLS----------ATVLRVVLVTFTF 424
            :|.|::.::.:|...||...|.        |.|  |:.||.|          :..:.:.:|...|
  Fly   370 SILLTFPIECFVSREIVRALVHRFVLKEPISEF--TQDKDPSLEKGAIIDEYSKAITMAIVFSAF 432

  Fly   425 LLATCIPNLGSIISLVGAVSSSALALIAP 453
            :::.....|||::.|.|.:::..||.|.|
  Fly   433 VISPMTDCLGSVLELNGLLAAIPLAYILP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13384NP_723383.1 SdaC 92..484 CDD:223884 87/400 (22%)
SLC5-6-like_sbd 94..495 CDD:294310 87/398 (22%)
CG13743NP_610444.2 SLC5-6-like_sbd 95..500 CDD:294310 88/410 (21%)
SdaC 95..491 CDD:223884 88/410 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468330
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22950
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.