DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13384 and SLC38A11

DIOPT Version :9

Sequence 1:NP_723383.1 Gene:CG13384 / 34160 FlyBaseID:FBgn0032036 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001338466.1 Gene:SLC38A11 / 151258 HGNCID:26836 Length:462 Species:Homo sapiens


Alignment Length:408 Identity:87/408 - (21%)
Similarity:159/408 - (38%) Gaps:87/408 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RDL--------EH----PTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTH 142
            |||        ||    .|.....|.:::...||:||:.:|.:.|.||..:|:.           
Human    14 RDLDDRETLVSEHEYKEKTCQSAALFNVVNSIIGSGIIGLPYSMKQAGFPLGIL----------- 67

  Fly   143 CMHMLVNCSHELCRRFQQPSLDFSEVAYCSFESGPL-GLRRYSMLARRIVTTF-----LFITQIG 201
               :|...|:         ..|||.|..  .:.|.| |...|..|..:   ||     |.::.:.
Human    68 ---LLFWVSY---------VTDFSLVLL--IKGGALSGTDTYQSLVNK---TFGFPGYLLLSVLQ 115

  Fly   202 FCCVYFLFVALNI--KDVMDHYYKM-----PVQIYL----LIMLGPM---ILLNLVRNLKYLTPV 252
            |...:...::.||  .|.:...::.     |..:::    :|.|..:   :.|:|.||:..|..|
Human   116 FLYPFIAMISYNIIAGDTLSKVFQRIPGVDPENVFIGRHFIIGLSTVTFTLPLSLYRNIAKLGKV 180

  Fly   253 SLVAALLTVAGLAITFSYMLVDLPDVHTVKPVATWATLPLYFGTAIYAFEGIGVV---------- 307
            ||::..||...|.|..:..:...|  |..|....|.     |... .|.:.:||:          
Human   181 SLISTGLTTLILGIVMARAISLGP--HIPKTEDAWV-----FAKP-NAIQAVGVMSFAFICHHNS 237

  Fly   308 LPLENNMRTPEDFGGTTGVLNTGMVI--VACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQL 370
            ..:.:::..| .....:.:::..:||  ..|::.|.  .|||.:....:|.:..|..:.|.|...
Human   238 FLVYSSLEEP-TVAKWSRLIHMSIVISVFICIFFAT--CGYLTFTGFTQGDLFENYCRNDDLVTF 299

  Fly   371 VRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTFTFLLATCIPNLGS 435
            .|....|.:.|:|.::.:|...:    :.:.|.......:...|:.|:::|...|::..|..||.
Human   300 GRFCYGVTVILTYPMECFVTREV----IANVFFGGNLSSVFHIVVTVMVITVATLVSLLIDCLGI 360

  Fly   436 IISLVGAVSSSALALIAP 453
            ::.|.|.:.::.|..|.|
Human   361 VLELNGVLCATPLIFIIP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13384NP_723383.1 SdaC 92..484 CDD:223884 85/406 (21%)
SLC5-6-like_sbd 94..495 CDD:294310 83/396 (21%)
SLC38A11NP_001338466.1 SLC5-6-like_sbd 37..418 CDD:320982 81/385 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.