DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13384 and SLC38A6

DIOPT Version :9

Sequence 1:NP_723383.1 Gene:CG13384 / 34160 FlyBaseID:FBgn0032036 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001166173.1 Gene:SLC38A6 / 145389 HGNCID:19863 Length:521 Species:Homo sapiens


Alignment Length:446 Identity:95/446 - (21%)
Similarity:185/446 - (41%) Gaps:72/446 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGLFGTMIMGAICTHCMHMLVNCSHE 153
            ||......|...::.:|:...:|:|||.:.....|.|::...|..:.:..:.::.:|:|::    
Human    38 HRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVLANTGVFGFSFLLLTVALLASYSVHLLLS---- 98

  Fly   154 LCRRFQQPSLDFSEVAYCSFESGPLGLRRYSMLARRIVTTFLFITQIGFCCVYFLFVALNIK--- 215
            :|          .:.|..|:|.  |||..:.:..:.:|...:.|..||....|.|.:...:.   
Human    99 MC----------IQTAVTSYED--LGLFAFGLPGKLVVAGTIIIQNIGAMSSYLLIIKTELPAAI 151

  Fly   216 ------DVMDHYYKMPVQIYLLIMLG---PMILLNLVRNLKYLTPVS----LVAALLTV-----A 262
                  |...::|.....:.::|.:|   |:.||..:..|.|.:.:|    :..||:.:     .
Human   152 AEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSI 216

  Fly   263 GLAITFSYM-----LVDLPD------VHTVKPVATWATLPLYFGTAIYAFEGIGVVLPLENNMRT 316
            ...:|.:|:     :.::.|      .|..|..|  ..||    |..::|.....:||:...:::
Human   217 PCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA--YALP----TMAFSFLCHTSILPIYCELQS 275

  Fly   317 PEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQ---GDTLSQLVRISMAVA 378
            |.. .....|.||.:.:...:|.....||||.:.:.||..:.....:   .|.:...|::.:..|
Human   276 PSK-KRMQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFA 339

  Fly   379 IFLSYTLQFYVPVNIVEPFVRSHFDTTRAKDLSATV-LRVVLVTFTFLLATCIPNLGSIISLVGA 442
            :.|:..|..:.....|.....|:|..:..:....|: |.:::|    |||..:|::.::..:|||
Human   340 VLLTVPLIHFPARKAVTMMFFSNFPFSWIRHFLITLALNIIIV----LLAIYVPDIRNVFGVVGA 400

  Fly   443 VSSSALALIAPPIIEVITFYNVGYGRFNWMLWKDV--LILIFGL-CGFVFGTWASL 495
            .:|:.|..|.|.:     || :...|.:::.||.:  |||...| |..|.....:|
Human   401 STSTCLIFIFPGL-----FY-LKLSREDFLSWKKLGGLILSHRLACSGVISAHCNL 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13384NP_723383.1 SdaC 92..484 CDD:223884 89/429 (21%)
SLC5-6-like_sbd 94..495 CDD:294310 92/439 (21%)
SLC38A6NP_001166173.1 SLC5-6-like_sbd 46..429 CDD:294310 86/415 (21%)
SdaC 50..434 CDD:223884 86/416 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.