DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dad1 and dad1

DIOPT Version :9

Sequence 1:NP_609222.1 Gene:Dad1 / 34159 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001016940.1 Gene:dad1 / 549694 XenbaseID:XB-GENE-922821 Length:113 Species:Xenopus tropicalis


Alignment Length:111 Identity:78/111 - (70%)
Similarity:95/111 - (85%) Gaps:0/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VELSSVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFISTVSCF 66
            |.:.||:|:|.::||.:||::|||:|.||.||||||.:||:||.||||||||||||||||:|..|
 Frog     3 VSVLSVVSRFLDEYVSSTPQRLKLLDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGFISSVGSF 67

  Fly    67 VLAVCLRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFIG 112
            :|.||||:|.||||||.|.||||||.||||:||:.||||||:||||
 Frog    68 ILGVCLRIQINPQNKSDFQGISPERAFADFLFANTILHLVVINFIG 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:396608 75/106 (71%)
dad1NP_001016940.1 DAD 12..113 CDD:366921 72/100 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I3880
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1027
Inparanoid 1 1.050 166 1.000 Inparanoid score I4057
OMA 1 1.010 - - QHG54385
OrthoDB 1 1.010 - - D1586516at2759
OrthoFinder 1 1.000 - - FOG0004116
OrthoInspector 1 1.000 - - oto102396
Panther 1 1.100 - - LDO PTHR10705
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R877
SonicParanoid 1 1.000 - - X2855
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.