DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dad1 and DAD1

DIOPT Version :9

Sequence 1:NP_609222.1 Gene:Dad1 / 34159 FlyBaseID:FBgn0263852 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001335.1 Gene:DAD1 / 1603 HGNCID:2664 Length:113 Species:Homo sapiens


Alignment Length:107 Identity:77/107 - (71%)
Similarity:90/107 - (84%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFISTVSCFVLAV 70
            ||||:|..:|:.:||::|||:|.||.||||||.:||.||.||||||||||||||||.|..|:|||
Human     7 SVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAV 71

  Fly    71 CLRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFIG 112
            |||:|.|||||:.|.||||||.||||:||..|||||||||:|
Human    72 CLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dad1NP_609222.1 DAD 5..112 CDD:396608 76/105 (72%)
DAD1NP_001335.1 DAD 7..113 CDD:396608 76/105 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146018
Domainoid 1 1.000 162 1.000 Domainoid score I4000
eggNOG 1 0.900 - - E1_KOG1746
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1027
Inparanoid 1 1.050 162 1.000 Inparanoid score I4228
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54385
OrthoDB 1 1.010 - - D1586516at2759
OrthoFinder 1 1.000 - - FOG0004116
OrthoInspector 1 1.000 - - oto88520
orthoMCL 1 0.900 - - OOG6_103289
Panther 1 1.100 - - LDO PTHR10705
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R877
SonicParanoid 1 1.000 - - X2855
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.