DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlaRS and LOC797305

DIOPT Version :9

Sequence 1:NP_523511.2 Gene:AlaRS / 34156 FlyBaseID:FBgn0027094 Length:966 Species:Drosophila melanogaster
Sequence 2:XP_017207530.1 Gene:LOC797305 / 797305 -ID:- Length:161 Species:Danio rerio


Alignment Length:161 Identity:125/161 - (77%)
Similarity:137/161 - (85%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LKPEHILPGSMKDNFWEMGETGPCGPCSELHFDRIGGRSVPELVNMDDPDVLEIWNLVFIQYNRE 224
            ::...||||||||||||||:|||||||||:|:||||||....|||||||:|||||||||||:|||
Zfish     1 MEESRILPGSMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNMDDPNVLEIWNLVFIQFNRE 65

  Fly   225 SDGSLKQLPKKHIDCGMGFERLVSVIQNKRSNYDTDLFVPLFDAIQAGTGAPPYQGRVGADDVDG 289
            |:..||.|.||.||.|||.||||||:|||.||||||||||.|:|||.||||..|.|:|.|:|.||
Zfish    66 SETVLKPLSKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARAYTGKVSAEDTDG 130

  Fly   290 IDMAYRVLADHARTITIALADGGTPDNTGRG 320
            |||||||||||||||||||.|||.|||||||
Zfish   131 IDMAYRVLADHARTITIALYDGGRPDNTGRG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlaRSNP_523511.2 PLN02900 5..963 CDD:215487 125/161 (78%)
AlaRS_core 6..253 CDD:238360 69/92 (75%)
tRNA_SAD 529..>626 CDD:298782
tRNA_SAD 694..752 CDD:285247
DHHA1 888..957 CDD:280440
LOC797305XP_017207530.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D129373at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.