DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlaRS and LOC559142

DIOPT Version :9

Sequence 1:NP_523511.2 Gene:AlaRS / 34156 FlyBaseID:FBgn0027094 Length:966 Species:Drosophila melanogaster
Sequence 2:XP_021323632.1 Gene:LOC559142 / 559142 -ID:- Length:290 Species:Danio rerio


Alignment Length:403 Identity:189/403 - (46%)
Similarity:213/403 - (52%) Gaps:151/403 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTAKEVRNAYLDFFKEQKHIYVHSSSTIPLDDPTLLFANAGMNQFKPIFLGTADPNSEMSKWVRV 68
            |||.::|..::|||:..:|.|||||:||||||||||||||||||                     
Zfish     5 LTAAQIREKFIDFFRRHEHQYVHSSATIPLDDPTLLFANAGMNQ--------------------- 48

  Fly    69 ANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEICSWAWEFLTQRLALPKDRLY 133
                                                                             
Zfish    49 ----------------------------------------------------------------- 48

  Fly   134 VTYFGGDAASGLEPDLECKQMWLDLGLKPEHILPGSMKDNFWEMGETGPCGPCSELHFDRIGGRS 198
                                         ..||||||||||||||:|||||||||:|:||||||.
Zfish    49 -----------------------------SRILPGSMKDNFWEMGDTGPCGPCSEIHYDRIGGRD 84

  Fly   199 VPELVNMDDPDVLEIWNLVFIQYNRESDGSLKQLPKKHIDCGMGFERLVSVIQNKRSNYDTDLFV 263
            ...|||||||:.||||||||||:||||:..||.|.||.||.|||.||||||:|||.|||||||||
Zfish    85 AAHLVNMDDPNELEIWNLVFIQFNRESETVLKPLSKKSIDTGMGLERLVSVLQNKMSNYDTDLFV 149

  Fly   264 PLFDAIQAGTGAPPYQGRVGADDVDGIDMAYRVLADHARTITIALADGGTPDNTGRGYVLRRILR 328
            |.|:|||.||||..|.|:|.|:|.|||||||||||||||||||||.|||.|||||||        
Zfish   150 PYFEAIQKGTGARAYTGKVSAEDTDGIDMAYRVLADHARTITIALYDGGRPDNTGRG-------- 206

  Fly   329 RAVRYATEKLNAKPGFFATLVNTVVDLLGDAFPEVKKDPQHIIDIINEEELQFLKTLTRGRNLLN 393
                                        ||||||::|||..:.|||||||.||||||:|||.:|:
Zfish   207 ----------------------------GDAFPELRKDPYMVKDIINEEEAQFLKTLSRGRRILD 243

  Fly   394 RTIEKLGNQTTIP 406
            |.|:.||..||||
Zfish   244 RKIQSLGESTTIP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlaRSNP_523511.2 PLN02900 5..963 CDD:215487 188/402 (47%)
AlaRS_core 6..253 CDD:238360 97/246 (39%)
tRNA_SAD 529..>626 CDD:298782
tRNA_SAD 694..752 CDD:285247
DHHA1 888..957 CDD:280440
LOC559142XP_021323632.1 tRNA-synt_2c 6..>254 CDD:332954 184/398 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D129373at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.