DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlaRS and CG10802

DIOPT Version :9

Sequence 1:NP_523511.2 Gene:AlaRS / 34156 FlyBaseID:FBgn0027094 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_570062.1 Gene:CG10802 / 31318 FlyBaseID:FBgn0029664 Length:436 Species:Drosophila melanogaster


Alignment Length:484 Identity:98/484 - (20%)
Similarity:170/484 - (35%) Gaps:122/484 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 FENQFVNEITSGQKA-----------------GIVLDKTNFYAESGGQIYDQGALVKVNDEANEF 560
            |..:|..:|.|.:.|                 .::.:.|..:.|.|||..|.|.|       ..|
  Fly    10 FLKEFKTKIVSSEFATLDWTDPSGKVEKLKGFNVICEDTILFPEGGGQPCDYGTL-------GGF 67

  Fly   561 LVDRVYNRGGYILHIGVVEGTLKVGDELELHIDVERRWLTMKNHSATHALNHCLLQVLGKDTE-- 623
            .|..|..:|...:|......:.:...|:.|.:|.:||...|:.||..|.:.....:....||.  
  Fly    68 PVKNVQRKGSTAVHFVESPTSFEQDAEVLLTLDYQRRLDHMQQHSGQHLITALFDREFKYDTTSW 132

  Fly   624 QKGSLVVPEKLRFDFNSKAAMTIEQVSKTEQLTKEMVY--KNVPIYAKESKLAL----AKKIRGL 682
            ..||.|...:|    ::...::.|.:...|:...:::.  :.|.:...:.::|.    |:..|||
  Fly   133 SLGSTVSYIQL----STPHLISRESLDLIERQANDLIREGREVTVLLVDPEVAQEFQDARAPRGL 193

  Fly   683 RSVFDEVYPDPVRVISFGVPVDELEQNPDSEAGEQTSVEFCGGTHLRRSGHIMDFVISSEEAIAK 747
                    |.....::..|.::.:|.|            .|.|||:.....:....:...|.:..
  Fly   194 --------PKDHEGLARVVRIEGIESN------------MCCGTHVTNLSQLQCIKLLYAEKVKA 238

  Fly   748 GIRRIVALTGPEALKALKKSEAFEQEIVRLKATIDNDKSGKDSKSHVKEIVELTEQISHATIPYV 812
            .: .:..:.|...|  :|..|.|::|....:|.    |.|..  .|::.:.:|.:.:        
  Fly   239 NV-LVHFVVGERVL--VKLGEVFQREQQLTQAL----KGGPG--QHLELVQKLQQNV-------- 286

  Fly   813 KKDEMRNLLKGLKKTLDDKERALRAAVSVTVVERAKTLCEA----NPNATVLVEQ--LEA-FNNT 870
                     ||.:|......:....|       .|:.||:.    .|....|..:  :|. |.||
  Fly   287 ---------KGSRKYFQQLLKRYATA-------EAERLCDLPKKDRPKYFSLHRRDGIEVDFINT 335

  Fly   871 KALDAALKQVRSQLPDAAAMFLSVDADSKKIFCLSSVPKSAVEKGLKANEWVQHVSATLG----- 930
             .|.||        |:....||:|   |:.:|..||.....|.:|      ...:...||     
  Fly   336 -FLRAA--------PEGIFYFLTV---SESVFAGSSAKGHLVLRG------DPEIVGKLGPQFME 382

  Fly   931 ---GKGGGKPESAQASGTNYEKVDEIVQL 956
               |||.||.::.|....|..::.|..:|
  Fly   383 ILEGKGNGKEDNFQGKINNLARLQECQEL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlaRSNP_523511.2 PLN02900 5..963 CDD:215487 98/484 (20%)
AlaRS_core 6..253 CDD:238360
tRNA_SAD 529..>626 CDD:298782 24/98 (24%)
tRNA_SAD 694..752 CDD:285247 8/57 (14%)
DHHA1 888..957 CDD:280440 20/77 (26%)
CG10802NP_570062.1 AlaX 6..250 CDD:225427 51/271 (19%)
tRNA_SAD 43..229 CDD:298782 44/216 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.