DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and PHO13

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_010045.1 Gene:PHO13 / 851362 SGDID:S000002395 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:59/256 - (23%)
Similarity:101/256 - (39%) Gaps:45/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIDLSGTLHVEDEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGFQLDASEIYSS 71
            |.|..|.|.:..:..|..:|.|..|:..|..:.||||.:..|:....::....|..:...:|::|
Yeast    28 LFDCDGVLWLGSQALPYTLEILNLLKQLGKQLIFVTNNSTKSRLAYTKKFASFGIDVKEEQIFTS 92

  Fly    72 LSAAVSYVEN-ERLNP----YYILSE------------------DARQDFPPEDTRR-------Y 106
            ..|:..|:.: .:|.|    .::..|                  |:|.|.|.:..:.       .
Yeast    93 GYASAVYIRDFLKLQPGKDKVWVFGESGIGEELKLMGYESLGGADSRLDTPFDAAKSPFLVNGLD 157

  Fly   107 KD--SVVIGLAPKAFNYEQLNEAFNVLLENKNHKLIAVHQGKYYKRAEGLALGPGCFVKGLEFAT 169
            ||  .|:.||..|. ||.:|......|.::..| .:..:....:.:......|.|..::.|.|::
Yeast   158 KDVSCVIAGLDTKV-NYHRLAVTLQYLQKDSVH-FVGTNVDSTFPQKGYTFPGAGSMIESLAFSS 220

  Fly   170 GRTAKVIGKPNPYFFEGALA--GRDPASCVMIGDDANDDIVGAMSMGMQG-----ILVKTG 223
            .|.....||||.......::  ..|.:.|.|:||..|.|    |..|::|     :||.:|
Yeast   221 NRRPSYCGKPNQNMLNSIISAFNLDRSKCCMVGDRLNTD----MKFGVEGGLGGTLLVLSG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 59/256 (23%)
Hydrolase_6 7..98 CDD:290083 24/113 (21%)
DUF843 <84..136 CDD:114536 17/82 (21%)
Hydrolase_like 175..245 CDD:289983 17/56 (30%)
PHO13NP_010045.1 HAD_Pase_UmpH-like 24..308 CDD:319813 59/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.