DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and AT5G10460

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_196608.2 Gene:AT5G10460 / 830910 AraportID:AT5G10460 Length:306 Species:Arabidopsis thaliana


Alignment Length:253 Identity:55/253 - (21%)
Similarity:102/253 - (40%) Gaps:39/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIKGALIDLSGTLHVEDEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGFQLDAS 66
            :.|..|:|..|.||...:|.|.|:..||.|..:|..:..::|:::.:..|: |:|..:||.    
plant    22 NFKAWLLDQYGVLHDGKKPYPGAISTLKNLATAGAKIVIISNSSRRASTTM-EKLKGLGFD---- 81

  Fly    67 EIYSSLSAAVSYVE------NERLNPYYI---------------------LSEDARQDFPPEDTR 104
              .|..:.|::..|      ..|.:|::.                     |..:..::....|..
plant    82 --PSFFTGAITSGELTHQSLQRRDDPWFAALGRRCIHITWNDRGAISLEGLDLNVVENVEEADFV 144

  Fly   105 RYKDSVVIGLAPKAFNYEQLNEAFNVLLENKNHKLIAVHQGKYYKRAEG--LALGPGCFVKGLEF 167
            ....:..:||...:.:...::|...:|.::....|..:.....|...|.  ..:.||......| 
plant   145 LAHGTEALGLPSGSVSPRTIDELEKILEKSAARGLPMIVANPDYVTVEANVFHIMPGTLASKYE- 208

  Fly   168 ATGRTAKVIGKPNPYFFEG--ALAGRDPASCVMIGDDANDDIVGAMSMGMQGILVKTG 223
            ..|...|.:|||:...:|.  |:||.:|:..:.:||..:.||.||...|::.|.:..|
plant   209 ELGGEVKSMGKPHKMIYESAIAIAGVNPSESIAVGDSLHHDIRGANVSGIESIFITGG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 55/252 (22%)
Hydrolase_6 7..98 CDD:290083 24/117 (21%)
DUF843 <84..136 CDD:114536 7/72 (10%)
Hydrolase_like 175..245 CDD:289983 17/51 (33%)
AT5G10460NP_196608.2 HAD_like 24..302 CDD:319827 55/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1088513at2759
OrthoFinder 1 1.000 - - FOG0002535
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.