Sequence 1: | NP_609219.1 | Gene: | CG17294 / 34155 | FlyBaseID: | FBgn0032032 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080230.2 | Gene: | Pgp / 67078 | MGIID: | 1914328 | Length: | 321 | Species: | Mus musculus |
Alignment Length: | 273 | Identity: | 72/273 - (26%) |
---|---|---|---|
Similarity: | 115/273 - (42%) | Gaps: | 63/273 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 LIDLSGTLHVEDEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGFQLDAS----- 66
Fly 67 EIYSSLSAAVSYVENERL----NP-YYILSEDA--------------------RQDFPPE----- 101
Fly 102 ---DTRRYKDSVVIGLAPKAFNYEQLNEAFNVLLE--------NKNHKLIAVHQGKYYKRAEGLA 155
Fly 156 LGPGCFVKGLEFATGRTAKVIGKPNPYFFE--GALAGRDPASCVMIGDDANDDIVGAMSMGMQGI 218
Fly 219 LVKTG-KYLPDVK 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17294 | NP_609219.1 | HAD-SF-IIA-hyp3 | 3..251 | CDD:162372 | 72/273 (26%) |
Hydrolase_6 | 7..98 | CDD:290083 | 27/120 (23%) | ||
DUF843 | <84..136 | CDD:114536 | 19/92 (21%) | ||
Hydrolase_like | 175..245 | CDD:289983 | 21/59 (36%) | ||
Pgp | NP_080230.2 | HAD_Pase_UmpH-like | 28..319 | CDD:319813 | 72/273 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0647 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |