DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and LHPP

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_016871998.1 Gene:LHPP / 64077 HGNCID:30042 Length:381 Species:Homo sapiens


Alignment Length:229 Identity:86/229 - (37%)
Similarity:136/229 - (59%) Gaps:7/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IKGALIDLSGTLHVE----DEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGFQL 63
            ::|.|:|:||.|:..    ......:|||:.||:.|.:.|:|.||.::.|:|.|..:|.|:||.:
Human    11 VRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDI 75

  Fly    64 DASEIYSSLSAAVSYVENERLNPYYILSEDARQDFPPEDTRRYKDSVVIGLAPKAFNYEQLNEAF 128
            ...|:.:...||...::.:.|.||.::.:..|.:|...||.. .:.|||..|.::|:|:.:|.||
Human    76 SEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSN-PNCVVIADAGESFSYQNMNNAF 139

  Fly   129 NVLLENKNHKLIAVHQGKYYKRAEGLALGPGCFVKGLEFATGRTAKVIGKPNPYFFEGAL--AGR 191
            .||:|.:...||::.:|:|||...||.|..|.::|.||:|.|..|:|:|||:|.||:.||  .|.
Human   140 QVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGV 204

  Fly   192 DPASCVMIGDDANDDIVGAMSMGMQGILVKTGKY 225
            :....||||||...|:.||...||:.:.|:|||:
Human   205 EAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 86/229 (38%)
Hydrolase_6 7..98 CDD:290083 29/94 (31%)
DUF843 <84..136 CDD:114536 19/51 (37%)
Hydrolase_like 175..245 CDD:289983 25/53 (47%)
LHPPXP_016871998.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D535833at33208
OrthoFinder 1 1.000 - - FOG0002535
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.