DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and zgc:77375

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_991194.1 Gene:zgc:77375 / 402927 ZFINID:ZDB-GENE-040426-1827 Length:429 Species:Danio rerio


Alignment Length:278 Identity:70/278 - (25%)
Similarity:102/278 - (36%) Gaps:75/278 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GALIDLSGTLHVEDEPTPNAVEALKRLRDSG----VLVKFVTNTTKDSKATLHERLCRI-GFQLD 64
            |.|.|:.|.|.....|.|.|..|.::|.|:.    |.|.||||.....:....::|..| |..:.
Zfish    33 GLLFDIDGVLVRGKTPIPAAKRAFQKLVDTKGQFLVPVVFVTNAGNCLRQKKADQLSHILGVPIS 97

  Fly    65 ASEI---YSSLSAAVSYVENERL----NPYYILSEDA-----------RQDFPPED----TRRYK 107
            ..::   :|.|.....|.:...|    .|...::::.           |:.||..|    .||.|
Zfish    98 QDQVMMSHSPLRMFKKYHDKFVLVSGQGPVLDIAKNVGFTNVVSIDMLRESFPLLDMVDHNRRPK 162

  Fly   108 ------------DSVVIGLAPKAFNYE-QLNEAFNVLLENKN--------HK----LIAVHQG-K 146
                        ::||:...|  ..:| .|....:|||.|.|        |.    |:|.:.. .
Zfish   163 LPSSPVANLPRVEAVVLFGEP--IRWETNLQLIVDVLLTNGNLSSAYETAHSTHLPLLACNMDLM 225

  Fly   147 YYKRAEGLALGPGCFVKGLEF----ATGRTAK---VIGKPN--PYFFEGALAGRDPA-------- 194
            :...|.....|.|.|:..||.    .||:..|   ::|||:  .|.|...|. |:.|        
Zfish   226 WMAEAHSPRFGHGTFMVCLESIYKKITGKELKYEALMGKPSELTYHFAEFLI-REQAVERGWRAP 289

  Fly   195 --SCVMIGDDANDDIVGA 210
              |...|||:...||.||
Zfish   290 IRSLYAIGDNLMTDIYGA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 70/278 (25%)
Hydrolase_6 7..98 CDD:290083 25/113 (22%)
DUF843 <84..136 CDD:114536 18/83 (22%)
Hydrolase_like 175..245 CDD:289983 16/48 (33%)
zgc:77375NP_991194.1 Hydrolase_6 34..137 CDD:290083 24/102 (24%)
HAD-SF-IIA 35..310 CDD:273637 69/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.