DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and CG5567

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_649015.2 Gene:CG5567 / 39986 FlyBaseID:FBgn0036760 Length:330 Species:Drosophila melanogaster


Alignment Length:270 Identity:60/270 - (22%)
Similarity:115/270 - (42%) Gaps:49/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIDLSGTLHVEDEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGFQLDASEIYSS 71
            :.|..|.|.:..:....:|:.:.:|:..|..:.|.||.:..:::.|.::...:||.:..:.|.|:
  Fly    43 ITDCDGVLWIYGQALEGSVDVMNQLKGMGKSIYFCTNNSTKTRSELLKKGVELGFHIKENGIIST 107

  Fly    72 LSAAVSYVENERLNP--YYILSEDARQ----------------------DFPPEDTRRYKD--SV 110
            ..|..:|::....:.  :.|.||...:                      :|..:..:...|  :|
  Fly   108 AHATAAYLKRRNFSKRVFVIGSEGITKELDAVGIQHTEVGPEPMKGSLAEFMAQHLKLDTDIGAV 172

  Fly   111 VIGLAPKAFNYEQLNEAFNVLLENKNHKLIAVHQGKYYKRAEGLALGPGCFVKGLEFATGRTAKV 175
            |:|. .:.|::.::.:|.: .|.:.....:|.:..:.:.....:..|.|.||:.::....|...|
  Fly   173 VVGF-DEHFSFPKMMKAAS-YLNDPECLFVATNTDERFPMPNMIVPGSGSFVRAIQTCAERDPVV 235

  Fly   176 IGKPNPYFFEGALAGR--DPASCVMIGDDANDDIVGAMSMGMQGILVKTG--------------- 223
            ||||||...|..:..:  ||:..:||||.||.||:...:.|.|.:||.:|               
  Fly   236 IGKPNPAICESLVTEKKIDPSRTLMIGDRANTDILLGFNCGFQTLLVGSGIHQLKDVERWKLSQD 300

  Fly   224 ----KYLPDV 229
                |.:|||
  Fly   301 PEEKKLIPDV 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 60/270 (22%)
Hydrolase_6 7..98 CDD:290083 19/114 (17%)
DUF843 <84..136 CDD:114536 11/77 (14%)
Hydrolase_like 175..245 CDD:289983 27/76 (36%)
CG5567NP_649015.2 PGP_euk 40..318 CDD:273635 60/270 (22%)
Hydrolase_6 42..142 CDD:290083 19/98 (19%)
Hydrolase_like 235..318 CDD:289983 27/76 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453843
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.