DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and Lhpp

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_038939164.1 Gene:Lhpp / 361663 RGDID:1359187 Length:312 Species:Rattus norvegicus


Alignment Length:301 Identity:95/301 - (31%)
Similarity:147/301 - (48%) Gaps:55/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IKGALIDLSGTLHVEDEPT------PNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGF 61
            ::|.|:|:||.|:  |..|      ..:|||:.||:.|.:.|:|.||.::.|:..|...|.|:||
  Rat    11 VRGVLLDISGVLY--DSGTGGGAAIAGSVEAVARLKRSPLKVRFCTNESQKSRRELVGVLQRLGF 73

  Fly    62 QLDASEIYSSLSAAVSYVENERLNPYYILSEDARQDFPPEDTRRYKDSVVIGLAPKAFNYEQLNE 126
            .:...|:.:...|....::...|.|:.::.|..|.:|...|... .:.|||..|.:.|:|:.:|.
  Rat    74 DISEGEVTAPAPATCQILKERGLRPHLLIHEGVRSEFDDIDMSN-PNCVVIADAGEGFSYQNMNR 137

  Fly   127 AFNVLLENKNHKLIAVHQG------------------------------------------KYYK 149
            ||.||:|.:|..||::.:|                                          :|||
  Rat   138 AFQVLMELENPVLISLGKGLIVARGYSRLQVEAWINGSVGQDGEKSDCSLLAVRELPHTEPRYYK 202

  Fly   150 RAEGLALGPGCFVKGLEFATGRTAKVIGKPNPYFFEGAL--AGRDPASCVMIGDDANDDIVGAMS 212
            ...||.|..|.::|.||:|.|..|:|:|||:|.||..||  .|.:....:|||||...|:.||..
  Rat   203 ETSGLMLDVGGYMKALEYACGIEAEVVGKPSPEFFRSALQAIGVEAHQAIMIGDDIVGDVGGAQQ 267

  Fly   213 MGMQGILVKTGKYLPDVKPSPPPTA--LLENFAEAVDWIIQ 251
            .||:.:.|:|||:.|..:..|...|  .::|.|||||.::|
  Rat   268 CGMRALQVRTGKFRPGDEHHPEVRADGYVDNLAEAVDLLLQ 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 94/299 (31%)
Hydrolase_6 7..98 CDD:290083 29/96 (30%)
DUF843 <84..136 CDD:114536 18/51 (35%)
Hydrolase_like 175..245 CDD:289983 29/73 (40%)
LhppXP_038939164.1 HAD-SF-IIA-hyp3 11..309 CDD:162372 95/301 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D535833at33208
OrthoFinder 1 1.000 - - FOG0002535
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.