DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and Hdhd2

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001014173.2 Gene:Hdhd2 / 361351 RGDID:1308579 Length:384 Species:Rattus norvegicus


Alignment Length:225 Identity:110/225 - (48%)
Similarity:147/225 - (65%) Gaps:7/225 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LRDSGVLVKFVTNTTKDSKATLHERLCRIGFQLDASEIYSSLSAAVSYVENERLNPYYILSEDAR 95
            ||.:.|:|:|||||||:||..|.|||.::.|.:...||::||:||.:.:|..::.|..::.:.|.
  Rat   160 LRAASVMVRFVTNTTKESKRDLLERLRKLEFDISEEEIFTSLTAARNLIEQRQVRPMLLVDDRAL 224

  Fly    96 QDFPPEDTRRYKDSVVIGLAPKAFNYEQLNEAFNVLLENKNHKLIAVHQGKYYKRAEGLALGPGC 160
            .||....|.. .::|||||||:.|:|:.|||||.:||:..  .|||:|:.:||||.:|||||||.
  Rat   225 PDFTGVQTHD-PNAVVIGLAPEHFHYQLLNEAFRLLLDGA--PLIAIHKARYYKRKDGLALGPGP 286

  Fly   161 FVKGLEFATGRTAKVIGKPNPYFFEGALAGRD--PASCVMIGDDANDDIVGAMSMGMQGILVKTG 223
            ||..||:||...|.|:|||...||..||...|  |...||||||..||:.||.::||.|||||||
  Rat   287 FVTALEYATDTKAVVVGKPEKTFFLEALRDTDCAPEEAVMIGDDCRDDVDGAQNIGMLGILVKTG 351

  Fly   224 KY--LPDVKPSPPPTALLENFAEAVDWIIQ 251
            ||  ..:.|.:|||....|:|..|||.|:|
  Rat   352 KYKAADEEKINPPPYLTCESFPHAVDHILQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 109/223 (49%)
Hydrolase_6 7..98 CDD:290083 27/66 (41%)
DUF843 <84..136 CDD:114536 21/51 (41%)
Hydrolase_like 175..245 CDD:289983 37/73 (51%)
Hdhd2NP_001014173.2 Yos1 5..>64 CDD:285740
HAD-SF-IIA-hyp3 122..382 CDD:162372 110/225 (49%)
HAD_like <159..>211 CDD:304363 25/50 (50%)
Hydrolase_like 301..375 CDD:289983 37/73 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346128
Domainoid 1 1.000 86 1.000 Domainoid score I7964
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12667
Inparanoid 1 1.050 231 1.000 Inparanoid score I3363
OMA 1 1.010 - - QHG62919
OrthoDB 1 1.010 - - D1088513at2759
OrthoFinder 1 1.000 - - FOG0002535
OrthoInspector 1 1.000 - - oto96632
orthoMCL 1 0.900 - - OOG6_106325
Panther 1 1.100 - - LDO PTHR19288
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5124
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.