DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and CG10352

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001259468.1 Gene:CG10352 / 32147 FlyBaseID:FBgn0030348 Length:315 Species:Drosophila melanogaster


Alignment Length:278 Identity:61/278 - (21%)
Similarity:89/278 - (32%) Gaps:104/278 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGFQLDASEIYSSLSAAVSYVENERLNP 86
            |.:.|||..|...|..|.||||                          :|:|:...::|......
  Fly    42 PGSAEALAHLAHLGKDVTFVTN--------------------------NSISSVKEHIEKFEKQG 80

  Fly    87 YYILSEDARQDFPPEDT-----RRYK-DSVVIGLAPKAFNYEQLNEAFNVLLENKN---HKLIAV 142
            :  |..|..|...|..|     |..| :.::..||...|....:|..|.:..||.:   .:|..:
  Fly    81 H--LKIDEHQIVHPAQTICDHLRSIKFEGLIYCLATSPFKEILVNAGFRLAQENGSGIITRLKDL 143

  Fly   143 HQGKY--------------------YKRA-----------------------EGLALGPGCFVKG 164
            |:..:                    ..||                       :|..:|||.|:..
  Fly   144 HEAIFSGESVDAVIIDVDFNLSAAKLMRAHFQLQNPKCLFLAGAADALIPFGKGEIIGPGAFIDV 208

  Fly   165 LEFATGRTAKVIGKPNPYFFEGALAGRD-------------PASCVMIGDDANDDIVGAMSMGMQ 216
            :..|.||....:|||          |.|             |:..:.:||....||..|.:.|.|
  Fly   209 VTQAVGRQPITLGKP----------GEDLRKLLLERHREIPPSRVLFVGDSLASDIGFARASGYQ 263

  Fly   217 GILVKT-GKYLPDVKPSP 233
            .:||.| |..|.||:..|
  Fly   264 TLLVLTGGTKLEDVQRLP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 61/278 (22%)
Hydrolase_6 7..98 CDD:290083 17/75 (23%)
DUF843 <84..136 CDD:114536 14/57 (25%)
Hydrolase_like 175..245 CDD:289983 21/73 (29%)
CG10352NP_001259468.1 PGP_euk 23..296 CDD:273635 61/278 (22%)
Hydrolase_6 25..127 CDD:290083 25/112 (22%)
Hydrolase_like 220..293 CDD:289983 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.