DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and Hdhd5

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_006237308.2 Gene:Hdhd5 / 312680 RGDID:1306557 Length:423 Species:Rattus norvegicus


Alignment Length:349 Identity:78/349 - (22%)
Similarity:112/349 - (32%) Gaps:134/349 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GALIDLSGTLHVEDEPTPNAVEALKRLRDS----GVLVKFVTNT----TKDSKATLHERL-CRIG 60
            |.|.|:.|.|.......|.|:||..:|.:|    .|.|.||||.    .:|....|...| |:: 
  Rat    48 GLLFDIDGVLVRGHRVIPAALEAFSKLVNSQGQLQVPVVFVTNAGNILQRDKAQELSALLECKV- 111

  Fly    61 FQLDASEI---YSSLSAAVSY-------------VENERLNPY--YILSEDARQDFPP---EDTR 104
               |..::   :|.:...:.|             |||.|...:  .:..:|.|..||.   .|.:
  Rat   112 ---DPDQVILSHSPMKLFLQYHNKRMLVSGQGPLVENARALGFQNVVTVDDLRIAFPELDMVDLQ 173

  Fly   105 RYKDSVVIGLAPKA--------------FNYE-QLNEAFNVLLENKNHKLIAVHQGKYYKRAEGL 154
            |...::||...|::              ..:| .|....:|||.|.       |.|      .||
  Rat   174 RRPKTMVIRTRPRSDFPAIEGVLLLGEPVRWETNLQLITDVLLSNG-------HPG------AGL 225

  Fly   155 ALGP--------------------------GCFVKGLEF----ATGRTAK---VIGKPNPYFFEG 186
            |..|                          |.|:..||.    .||...|   ::|||:...:..
  Rat   226 ATAPYPHLPVLASNMDLLWMAEASMPRFGHGTFLLCLETIYRKITGHELKYEGLMGKPSILTYRY 290

  Fly   187 A-------LAGRDPASCV----MIGDDANDDIVGA--------MSMGMQ---------------- 216
            |       ...|..|:.:    .|||:...|:.||        |:.|.:                
  Rat   291 AEEVIRQQAERRGWAAPIRKLYAIGDNPMSDVYGANLFHQYLQMANGGEKEQRADGQEKQRPSAA 355

  Fly   217 ----GILVKTGKYLPDVKPSPPPT 236
                .:||.||.|......|..||
  Rat   356 RSCASVLVCTGIYSSQDPGSQAPT 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 78/349 (22%)
Hydrolase_6 7..98 CDD:290083 29/117 (25%)
DUF843 <84..136 CDD:114536 15/71 (21%)
Hydrolase_like 175..245 CDD:289983 22/101 (22%)
Hdhd5XP_006237308.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.