DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and Hdhd5

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_659064.1 Gene:Hdhd5 / 214932 MGIID:2136976 Length:419 Species:Mus musculus


Alignment Length:337 Identity:79/337 - (23%)
Similarity:113/337 - (33%) Gaps:114/337 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GALIDLSGTLHVEDEPTPNAVEALKRLRDS----GVLVKFVTNT---TKDSKATLHERLCRIGFQ 62
            |.|.|:.|.|.......|.|:||..:|.:|    .|.|.||||.   .:.:||.....|.|.  :
Mouse    48 GLLFDIDGVLVRGHRVIPAALEAFSKLVNSQGQLRVPVVFVTNAGNILQHNKAQELSDLLRC--K 110

  Fly    63 LDASEI------------YSSLSAAVS----YVENERLNPY--YILSEDARQDFP---------- 99
            :|..::            |.|....||    .|||.|...:  .:..::.|..||          
Mouse   111 VDPDQVILSHSPMKLFLQYHSKQMLVSGQGPLVENARALGFQNVVTIDELRLAFPELDMVDLQRR 175

  Fly   100 PEDTRRYKDSVVIG---LAPKAFNYE-QLNEAFNVLLEN-------------------KNHKLIA 141
            |:..|...|...|.   |..:...:| .|....:|||.|                   .|..|:.
Mouse   176 PKTMRLRSDFPAIEGVLLLGEPVRWETNLQLIMDVLLSNGHPGTGLATAPYPHLPVLASNMDLLW 240

  Fly   142 VHQGKYYKRAEGLALGPGCFVKGLEF----ATGRTAK---VIGKPNPYFFEGA-------LAGRD 192
            :.:.|..:      .|.|.|:..||.    .||...|   ::|||:...::.|       ...|.
Mouse   241 MAEAKMPR------FGHGTFLLCLETIYRKITGNELKYEGLMGKPSILTYQYAEDVIRQQAERRG 299

  Fly   193 PASCV----MIGDDANDDIVGA------MSMGMQG----------------------ILVKTGKY 225
            .|:.:    .|||:...|:.||      :.|..:|                      |||.||.|
Mouse   300 WAAPIRKLYAIGDNPMSDVYGANLFHQYLQMANRGEEEQQTGGQQKQRPSATQSCASILVCTGIY 364

  Fly   226 LPDVKPS--PPP 235
            ......|  |||
Mouse   365 SSQDPGSQVPPP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 79/337 (23%)
Hydrolase_6 7..98 CDD:290083 30/115 (26%)
DUF843 <84..136 CDD:114536 14/86 (16%)
Hydrolase_like 175..245 CDD:289983 24/102 (24%)
Hdhd5NP_659064.1 CECR5 47..358 CDD:200106 69/317 (22%)
Hydrolase_6 49..152 CDD:290083 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.