DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and C45E5.1

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_500857.2 Gene:C45E5.1 / 183469 WormBaseID:WBGene00016664 Length:303 Species:Caenorhabditis elegans


Alignment Length:263 Identity:60/263 - (22%)
Similarity:99/263 - (37%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIDLSGTLHVEDEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKATLHE-----RLCRIGFQLDAS 66
            :.|..|.|...|.|.|.|.|.:..|.|......|:  ||.:|..||.:     :..|.| :|...
 Worm    19 VFDADGVLWTGDIPIPGAAEWINTLLDDPEKSVFI--TTNNSTKTLEQYMKKVKKMRFG-RLGRE 80

  Fly    67 EIYSSLSAAVSY-------VENERLNPYYILSEDARQDFP-----------PEDTRRYKDSVVI- 112
            .:.|.......|       .||:.:  |.|..|:.::...           |:....|.|...| 
 Worm    81 NLLSPTIVLCDYFKQNSDKFENQYI--YLIGVENLKKSLEEGGGVKCFGTGPDHKDNYTDGDFIN 143

  Fly   113 -----GLAPKA--------FNYEQLNEAFNVLLENKNHKLIAVHQGKYYKRAEGLAL---GPGCF 161
                 ...|||        |:|.:|.:|.|.|.:.....|:......:.....|:.|   ||  :
 Worm   144 EVDVKSKIPKAVVVSFDSHFSYPKLMKAANFLADPLVEFLVCNEDSTFPGPVPGMILPETGP--W 206

  Fly   162 VKGLEFATGRTAKVI-GKPNPY---FFEGAL-AGR-DPASCVMIGDDANDDIVGAMSMGMQGILV 220
            ...::..:||...:: |||:..   |.:..: ||: :....||.||..:.|::...:.|...:.:
 Worm   207 SAAIQNVSGRKPDIVFGKPHEQLANFLKSRVQAGKFNSERTVMFGDRLDTDMMFGKNNGFTTVWM 271

  Fly   221 KTG 223
            :||
 Worm   272 QTG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 60/263 (23%)
Hydrolase_6 7..98 CDD:290083 26/102 (25%)
DUF843 <84..136 CDD:114536 16/76 (21%)
Hydrolase_like 175..245 CDD:289983 14/55 (25%)
C45E5.1NP_500857.2 HAD-SF-IIA 18..274 CDD:273637 58/261 (22%)
Hydrolase_6 18..121 CDD:290083 26/106 (25%)
Hydrolase_like 221..284 CDD:289983 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.