DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and K02D10.1

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_498939.3 Gene:K02D10.1 / 176232 WormBaseID:WBGene00019301 Length:526 Species:Caenorhabditis elegans


Alignment Length:236 Identity:56/236 - (23%)
Similarity:96/236 - (40%) Gaps:34/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIDLSGTLHVEDEPTPNAVEALK-RLRDSGVLVKFVTNTTKDSKATLHERLCRIGF-QLDASEIY 69
            |.|..|.|...|.|.|.|:|.:. .|.|....|..:||.:..:.....:::.::|| .|..:.:.
 Worm    19 LFDADGVLWTGDIPVPGAIEWINLLLEDPSKKVFVLTNNSTKTLEQYMKKIEKLGFGHLGRNNVI 83

  Fly    70 SSLSAAVSYVEN--ERLNPYYIL---SEDARQDFP-----------PEDTRRYKD-----SVVIG 113
            |.......|:::  ::.:..|:.   :|:.:....           |:..|.:.|     .|.:.
 Worm    84 SPAIVLADYLKSNADKFSGEYVYLIGTENLKATLENDGGVKCFGTGPDSIRDHTDGDFIHKVDMS 148

  Fly   114 LAPKA--------FNYEQLNEAFNVLLENKNHKLIAVHQGKYYKRAEGLAL-GPGCFVKGLEFAT 169
            :||||        |:|.::.:|.|.|.:.....|:......:.....|:.: |.|.....:...|
 Worm   149 IAPKAVVCSYDAHFSYPKIMKASNYLQDPSVEYLVTNQDYTFPGPVPGVVIPGSGATSAAVTAVT 213

  Fly   170 GRTAKVIGKPNPYFFEGAL--AGRDPASCVMIGDDANDDIV 208
            ||..||.|||:....:..|  |..||...||.||..:.||:
 Worm   214 GRDPKVFGKPHKPMADFLLRRAHVDPKRTVMFGDRLDTDIM 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 56/236 (24%)
Hydrolase_6 7..98 CDD:290083 21/97 (22%)
DUF843 <84..136 CDD:114536 15/78 (19%)
Hydrolase_like 175..245 CDD:289983 14/36 (39%)
K02D10.1NP_498939.3 HAD-SF-IIA 18..264 CDD:273637 56/236 (24%)
Hydrolase_6 18..121 CDD:290083 21/101 (21%)
Hydrolase_like 219..>260 CDD:289983 14/36 (39%)
NIPSNAP 427..524 CDD:285252
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.