DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17294 and lhpp

DIOPT Version :9

Sequence 1:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_002937837.3 Gene:lhpp / 100498369 XenbaseID:XB-GENE-955676 Length:270 Species:Xenopus tropicalis


Alignment Length:263 Identity:90/263 - (34%)
Similarity:152/263 - (57%) Gaps:10/263 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIKGALIDLSGTLHVE-----DEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGF 61
            :::..|:|:||.|:..     ......:|:|:.|:|.:|:.::|.||.::.:::...::|.|.||
 Frog     7 NVRAVLLDVSGVLYDSGGSGGGSAIQGSVDAVNRIRQAGLKLRFCTNESQATRSHFAQKLQRFGF 71

  Fly    62 QLDASEIYSSLSAAVSYVENERLNPYYILSEDARQDFPPEDTRRYKDSVVIGLAPKAFNYEQLNE 126
            .:...|:.:...||...::.:.|.|:.::.:|...:|...:|.. .:.|:||.|.:.|:|:.:|.
 Frog    72 SISKEEVTAPGPAATRLMKEQGLRPHLLVHDDLLPEFESIETSD-PNCVLIGDAAENFSYQNVNR 135

  Fly   127 AFNVLLENKNHKLIAVHQGKYYKRAEGLALGPGCFVKGLEFATGRTAKVIGKPNPYFFEGAL--A 189
            ||.||:..:...||::.:|:|||..:||.|..|.::|.||:|....|:|:|||:|.||..||  .
 Frog   136 AFQVLINLQKPVLISLGKGRYYKETDGLKLDVGAYMKALEYACDIKAEVVGKPSPNFFLSALEEM 200

  Fly   190 GRDPASCVMIGDDANDDIVGAMSMGMQGILVKTGKYLPDVKPSPPPTA--LLENFAEAVDWIIQK 252
            |..|...||||||..:||.||.|.|::.:||:||||.|..:..|..||  .::|.|.|||.::..
 Frog   201 GAKPEEAVMIGDDIVNDIGGAQSCGIRAVLVRTGKYRPSDEKHPEVTADGYVDNLAHAVDILLAS 265

  Fly   253 NQS 255
            ..|
 Frog   266 RAS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 89/256 (35%)
Hydrolase_6 7..98 CDD:290083 23/95 (24%)
DUF843 <84..136 CDD:114536 16/51 (31%)
Hydrolase_like 175..245 CDD:289983 35/73 (48%)
lhppXP_002937837.3 HAD_PPase 9..263 CDD:319812 89/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10288
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D535833at33208
OrthoFinder 1 1.000 - - FOG0002535
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.