DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and Pla1a

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_620237.1 Gene:Pla1a / 85311 RGDID:621261 Length:456 Species:Rattus norvegicus


Alignment Length:348 Identity:92/348 - (26%)
Similarity:146/348 - (41%) Gaps:58/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KFILYYGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVES-IHVIAEAYLERKD 89
            :|:|:   |.:|.....|.:..|.:.:...:....|.|.:||:.......| |:....|.|...|
  Rat    52 QFLLF---TPSDPGCGQLVEEDSDIRNSEFNASLGTKLIIHGFRALGTKPSWINKFIRALLRAAD 113

  Fly    90 TNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKMFDHGLDIEKFHIVGHSMGGQLAGLLGR 154
            .|:|.:||...:.|.| |.|..|:.:|..|:::.|.|:.:.|:.....||:|.|:|..:.|::|.
  Rat   114 ANVIAVDWVYGSTGMY-FSAVENVVKLSLEISRFLSKLLELGVSESSIHIIGVSLGAHVGGMVGH 177

  Fly   155 EITKRTKGVRKIKRISALDPAFPLFYPGT---HLSANDAEFVDVIHTDAWLYGAPTSTGTADFWP 216
            ..    ||  ::.||:.||||.|.:...:   .|.:.||.||:.||||....|.....|..|::.
  Rat   178 FY----KG--QLGRITGLDPAGPEYTRASLEERLDSGDALFVEAIHTDTDNLGIRIPVGHVDYFV 236

  Fly   217 NGGYSLQPGCP---KRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQ---- 274
            |||.. |||||   ...|..|    :..|.|:...:..::.:..|:  .|.|...:..|..    
  Rat   237 NGGQD-QPGCPAFIHAGYSYL----ICDHMRAVHLYISALENTCPL--MAFPCASYKAFLAGDCL 294

  Fly   275 ---NKIVENCPPV-------VMGHHCPTTIHGDFYLQTNGHTPFA-------------RGKEGTV 316
               |..:.:||.:       |.....|..:.  .||||....|:.             |.|:.::
  Rat   295 DCFNPFLLSCPRIGLVERGGVKIEPLPKEVR--VYLQTTSSAPYCVHHSLVEFNLKEKRKKDTSI 357

  Fly   317 YVDPKDLLGN--THSITCDCPSE 337
            .|   ..|||  |.|:....|.:
  Rat   358 EV---TFLGNNVTSSVKITIPKD 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 81/297 (27%)
Pla1aNP_620237.1 Lipase 14..336 CDD:278576 82/302 (27%)
Pancreat_lipase_like 49..332 CDD:238363 82/298 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.