DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and Pla1a

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_598863.3 Gene:Pla1a / 85031 MGIID:1934677 Length:456 Species:Mus musculus


Alignment Length:349 Identity:89/349 - (25%)
Similarity:144/349 - (41%) Gaps:58/349 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KFILYYGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVES-IHVIAEAYLERKD 89
            :|:|:   |.:|.....|.:..|.:.....:....|.:.:||:.......| |.....|.|...|
Mouse    52 QFLLF---TPSDPSCGQLVEEGSDIRSSEFNASLGTKVIIHGFRALGTKPSWIDKFISAVLRAAD 113

  Fly    90 TNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKMFDHGLDIEKFHIVGHSMGGQLAGLLGR 154
            .|:|.:||...:.|.| :.|..|:.:|..|:::.|.|:.:.|:.....||:|.|:|..:.|::|.
Mouse   114 ANVIAVDWVYGSTGVY-YSAVENVVKLSLEISRFLSKLLELGVSESSIHIIGVSLGAHVGGMVGH 177

  Fly   155 EITKRTKGVRKIKRISALDPAFPLFYPGT---HLSANDAEFVDVIHTDAWLYGAPTSTGTADFWP 216
            ..    ||  ::.:|:.||||.|.:...:   .|.|.||.||:.||||....|.....|..|::.
Mouse   178 FY----KG--QLGQITGLDPAGPEYTRASLEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFV 236

  Fly   217 NGGYSLQPGCP---KRNYKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQ---- 274
            |||.. |||||   ...|..|    :..|.|:...:..::.:..|:  .|.|...:..|..    
Mouse   237 NGGQD-QPGCPAFFHAGYNYL----ICDHMRAVHLYISALENTCPL--MAFPCASYKAFLAGDCL 294

  Fly   275 ---NKIVENCPPV-------VMGHHCPTTIHGDFYLQTNGHTPFA-------------RGKEGTV 316
               |..:.:||.:       ||....|..:  ..||.|....|:.             |.|:.::
Mouse   295 DCFNPFLLSCPRIGLVERGGVMIEPLPKEV--KVYLLTTSSAPYCVHHSLVEFYLKEKRKKDTSI 357

  Fly   317 YVDPKDLLGN--THSITCDCPSEK 338
            .|   ..|.|  |.|:....|.::
Mouse   358 EV---TFLSNNVTSSVKITIPKQQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 79/297 (27%)
Pla1aNP_598863.3 Lipase 14..336 CDD:333880 80/302 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.