DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:327 Identity:99/327 - (30%)
Similarity:154/327 - (47%) Gaps:68/327 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KFILY--YGPTVADSDIYDLTDFQSLLEDEHLDLG-------KNTVLYLHGYLEDPDVESIHVIA 81
            :|:||  ..||.          ||:|...:.|.:|       :.|...:||:::..:...:..:.
  Rat    55 RFLLYTNENPTA----------FQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKGEENWVVDMC 109

  Fly    82 EAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAK---VLLKMFDHGLDIEKFHIVGHS 143
            :...:.::.|.|.:||.:.:...|. .|..|::.:|.::|:   :|:|.:.:  ...|.|::|||
  Rat   110 KNMFQVEEVNCICVDWKKGSQTTYT-QAANNVRVVGAQVAQMIDILVKNYSY--SPSKVHLIGHS 171

  Fly   144 MGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGT----HLSANDAEFVDVIHTDA---- 200
            :|..:||    |...||.|   :.||:.|||....| .||    .|..:||:|||||||||    
  Rat   172 LGAHVAG----EAGSRTPG---LGRITGLDPVEANF-EGTPEEVRLDPSDADFVDVIHTDAAPLI 228

  Fly   201 -WL-YGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDND----------LSSHRRSWWFWAESV 253
             :| :|....:|..||:||||.|: |||.|.....:.|.|          ..:|.||:.::.||:
  Rat   229 PFLGFGTNQMSGHLDFFPNGGQSM-PGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESI 292

  Fly   254 SDRYPIGFDAVPAKKWSDFKQNKIV----ENCPPVVMGHHCPTTI--HGD----FYLQTNGHTPF 308
            .:  |.||.|.|...:.||:.||..    :.||.  |||:.....  .||    |:|.|.....|
  Rat   293 LN--PDGFAAYPCASYKDFESNKCFPCPDQGCPQ--MGHYADKFAGKSGDEPQKFFLNTGEAKNF 353

  Fly   309 AR 310
            ||
  Rat   354 AR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 95/318 (30%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 96/323 (30%)
PLAT_PL 356..467 CDD:238857 99/327 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.