DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17292 and Liph

DIOPT Version :9

Sequence 1:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_038944552.1 Gene:Liph / 681694 RGDID:1592849 Length:476 Species:Rattus norvegicus


Alignment Length:255 Identity:72/255 - (28%)
Similarity:119/255 - (46%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LDLGKNTVLYLHGY--LEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLG 117
            |::.|.|...:||:  ...|.| .:..:.::.:..::.|::|:||...|    ....:|:.....
  Rat   102 LNVTKKTTFIIHGFRPTGSPPV-WMEELVQSLISVQEMNVVVVDWNRGA----TTVIYPHASSKT 161

  Fly   118 PELAKVLLKMFDH----GLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPL 178
            .::|.:|.:..|.    |..::..:::|.|:|..:||.:|...:      .|:.||:.||||.||
  Rat   162 RKVALILKEFIDQMLAKGASLDNIYMIGVSLGAHIAGFVGEMYS------GKLGRITGLDPAGPL 220

  Fly   179 FY---PGTHLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPK------RNYKML 234
            |.   |...|..:||:||||||:|....|...:.|..||:||||.. ||||||      :.:|  
  Rat   221 FNGRPPEDRLDPSDAQFVDVIHSDTDALGYREALGHIDFYPNGGLD-QPGCPKTIFGGIKYFK-- 282

  Fly   235 SDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENCPPVVMGH--HCPT 292
                 ..|:.|.:.:..|:.:...|  .|.|...:.|::..|    |.....||  .||:
  Rat   283 -----CDHQMSVFLYLASLQNNCSI--TAYPCDSYRDYRNGK----CVSCGAGHIVSCPS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 72/255 (28%)
LiphXP_038944552.1 Pancreat_lipase_like 78..347 CDD:238363 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.